PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.12302s0137.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family WOX
Protein Properties Length: 251aa    MW: 28424.8 Da    PI: 10.1052
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.12302s0137.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox66.14.7e-2188147357
                           --SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
              Homeobox   3 kRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                           +R+++t+eq+ +Le l++   r+p+a+++e+++++l    +++ ++V++WFqN++a+e++
  Bostr.12302s0137.1.p  88 TRWNPTQEQIGILEMLYKGgMRTPNAQQIEHITSQLgkygKIEGKNVFYWFQNHKARERQ 147
                           7*****************99**************************************97 PP

2Wus_type_Homeobox116.71e-3788149465
     Wus_type_Homeobox   4 tRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65 
                           tRW+Pt+eQi iLe+lyk G+rtPn+++i++it++L +yGkie+kNVfyWFQN+kaRerqkq
  Bostr.12302s0137.1.p  88 TRWNPTQEQIGILEMLYKGGMRTPNAQQIEHITSQLGKYGKIEGKNVFYWFQNHKARERQKQ 149
                           8***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007110.02583148IPR001356Homeobox domain
SuperFamilySSF466892.44E-1284152IPR009057Homeodomain-like
SMARTSM003892.0E-785152IPR001356Homeobox domain
PfamPF000461.0E-1888147IPR001356Homeobox domain
CDDcd000866.87E-588149No hitNo description
Gene3DG3DSA:1.10.10.607.2E-889147IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0001944Biological Processvasculature development
GO:0007165Biological Processsignal transduction
GO:0010067Biological Processprocambium histogenesis
GO:0051301Biological Processcell division
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 251 aa     Download sequence    Send to blast
MKVHEFSNGF SSSWDQHDST SSLSLSCKRL RPLAPKLSGS PPSPPSSSSG VTSATFDLKS  60
FIRPDQTGPT KFEHKRDPPQ LETHPGGTRW NPTQEQIGIL EMLYKGGMRT PNAQQIEHIT  120
SQLGKYGKIE GKNVFYWFQN HKARERQKQK RNNLISLNCQ SSFTTTSVSN PSVTTKTRTS  180
SSLDIRRDSV VEKHELVEEN EYKRTCRSWG FENLEIEGRR NKNSSTMTTT FHKIIDNVTL  240
ELFPLHPEGR *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY2513960.0AY251396.1 Arabidopsis thaliana WOX4 protein mRNA, complete cds.
GenBankBT0106920.0BT010692.1 Arabidopsis thaliana At1g46480 mRNA, complete cds.
GenBankBT0109740.0BT010974.1 Arabidopsis thaliana At1g46480 mRNA, complete cds.
GenBankFJ4408500.0FJ440850.1 Arabidopsis thaliana WOX4 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006305551.11e-172hypothetical protein CARUB_v10010093mg
SwissprotQ6X7J91e-156WOX4_ARATH; WUSCHEL-related homeobox 4
TrEMBLR0I7Y81e-171R0I7Y8_9BRAS; Uncharacterized protein
STRINGscaffold_104273.11e-156(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM59802747
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G46480.11e-132WUSCHEL related homeobox 4